HPA001335

PTGS2 antibody from Sigma-Aldrich
COX2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001335
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001335, RRID:AB_1079712
Product name
Anti-PTGS2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001335
Antibody type
Polyclonal
Antigen
Prostaglandin G/H synthase 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAE
LEALYGDIDAVELYPALLVEKPRPDAIFGETMVEV
GAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIIN
TASIQSLICNNVKGCPFTSFSVPDPE
Storage
-20C
Provider Type Product Number
- No reagents -