HPA023893

ZBTB34 antibody from Atlas Antibodies
KIAA1993, MGC24652, ZNF918
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023893
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023893, RRID:AB_2219180
Product name
Anti-ZBTB34
Provider product page
Atlas Antibodies - HPA023893
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GSVSEYEIQIEGDHEQGDLLVRESQITEVKVKMEK
SDRPSCSDSSSLGDDGYHTEMVDGEQVVAVNVGSY
GSVLQHAYSYSQAA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -