HPA023893

ZBTB34 antibody from MilliporeSigma / Merck KGaA
KIAA1993, MGC24652, ZNF918
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023893
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA023893, RRID:AB_2219180
Product name
Anti-ZBTB34 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA023893
Antibody type
Polyclonal
Antigen
Zinc finger and BTB domain-containing protein 34 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GSVSEYEIQIEGDHEQGDLLVRESQITEVKVKMEK
SDRPSCSDSSSLGDDGYHTEMVDGEQVVAVNVGSY
GSVLQHAYSYSQAA
Storage
-20C
Provider Type Product Number
- No reagents -