H00003929-M01A

LBP antibody from Abnova Corporation
BPIFD2
No application information provided.

Antibody data

Product number
H00003929-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003929-M01A, RRID:AB_1136953
Product name
LBP monoclonal antibody (M01A), clone 4E8
Provider product page
Abnova Corporation - H00003929-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant LBP.
Antigen sequence
ANPGLVARITDKGLQYAAQEGLLALQSELLRITLP
DFTGDLRIPHVGRGRYEFHSLNIHSCELLHSALRP
VPGQGLSLSISDSSIRVQGRWKVRKSFFKLQGSFD
VSVKGISISVDLLLGSESSGRPTVTASSCSSDIAD
VEVDMSGDLGWLLNLFHNQIESKFQKVLESRICEM
IQKSVSSDLQPYLQTLPVTTEIDSFADIDYSLVEA
PRATAQMLEVMFKGEIFHRNHRSPVTLLAAVMSLP
EEHNKMVYFAISDYVFNTASLVYHEEGYLNFSITD
DMIPPDSNIRLTTKSFRPFVPRLARLYPNMNLELQ
GSVPSAPLLNFSPGNLSVDPYMEIDAFVLLPSSSK
EPVFRLSVATNVSATLTFNTSKITGFLKPGKVKVE
LKESKVGLFNAELLEALLNYYILNTFYPKFNDKLA
EGFPLPLLKRVQLYDLGLQIHKDFPSRRDHPP
Isotype
IgM
Antibody clone number
4E8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -