HPA001508

LBP antibody from Sigma-Aldrich
BPIFD2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001508
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001508, RRID:AB_1079241
Product name
Anti-LBP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001508
Antibody type
Polyclonal
Antigen
Lipopolysaccharide-binding protein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EGYLNFSITDDMIPPDSNIRLTTKSFRPFVPRLAR
LYPNMNLELQGSVPSAPLLNFSPGNLSVDPYMEID
AFVLLPSSSKEPVFRLSVATNVSATLTFNTSKITG
FLKPGKVKVELKESKVGLFNAELLEALLNYYI
Storage
-20C
Provider Type Product Number
- No reagents -