Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501763 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-RING1 and YY1 Binding Protein (RYBP) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RYBP antibody: synthetic peptide directed towards the N terminal of human RYBP
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
MTMGDKKSPTRPKRQAKPAADEGFWDCSVCTFRNS
AEAFK CSICDVRKGT- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Human death effector domain-associated factor interacts with the viral apoptosis agonist Apoptin and exerts tumor-preferential cell killing.
Danen-van Oorschot AA, Voskamp P, Seelen MC, van Miltenburg MH, Bolk MW, Tait SW, Boesen-de Cock JG, Rohn JL, Borst J, Noteborn MH
Cell death and differentiation 2004 May;11(5):564-73
Cell death and differentiation 2004 May;11(5):564-73
No comments: Submit comment
No validations: Submit validation data