HPA021539

XG antibody from Sigma-Aldrich
PBDX
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021539
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021539, RRID:AB_1858882
Product name
Anti-XG antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021539
Antibody type
Polyclonal
Antigen
Glycoprotein Xg Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RDFDLADALDDPEPTKKPNSDIYPKPKPPYYPQPE
NPDSGGNIYPRPKPRPQPQPGNSGNSGGYFNDVDR
DDGRYPPRPRPRPPAGGGGGGYSSYGNSDNTHGRG
GYRPNSRYGNTYGGDHHSTYGNPEGNMV
Storage
-20C
Provider Type Product Number
- No reagents -