HPA026815

BRCA2 antibody from MilliporeSigma / Merck KGaA
BRCC2, FACD, FAD, FAD1, FANCD, FANCD1, XRCC11
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026815
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-BRCA2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA026815
Antibody type
Polyclonal
Antigen
breast cancer 2, early onset recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VHPISLSSSKCHDSVVSMFKIENHNDKTVSEKNNK
CQLILQNNIEMTTGTFVEEITENYKRNTENEDNKY
TAASRNSHNLEFDGSDSSKNDTVCIHKDETDLLFT
DQHNICLKLSGQFMKEGNTQIKEDLS
Storage
-20C