Antibody data
- Product number
- HPA024006
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA024006, RRID:AB_1844987
- Product name
- Anti-ARG1
- Provider product page
- Atlas Antibodies - HPA024006
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVM
EETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTP
VVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSL
GKTPEEVTRTVNTAVAITL
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Interleukin-6/interleukin-21 signaling axis is critical in the pathogenesis of pulmonary arterial hypertension.
Hashimoto-Kataoka T, Hosen N, Sonobe T, Arita Y, Yasui T, Masaki T, Minami M, Inagaki T, Miyagawa S, Sawa Y, Murakami M, Kumanogoh A, Yamauchi-Takihara K, Okumura M, Kishimoto T, Komuro I, Shirai M, Sakata Y, Nakaoka Y
Proceedings of the National Academy of Sciences of the United States of America 2015 May 19;112(20):E2677-86
Initial Quantitative Proteomic Map of 28 Mouse Tissues Using the SILAC Mouse
Geiger T, Velic A, Macek B, Lundberg E, Kampf C, Nagaraj N, Uhlen M, Cox J, Mann M
Molecular & Cellular Proteomics 2013 June;12(6):1709-1722
Expression patterns of the immunomodulatory enzyme arginase 1 in blood, lymph nodes and tumor tissue of early-stage breast cancer patients.
de Boniface J, Mao Y, Schmidt-Mende J, Kiessling R, Poschke I
Oncoimmunology 2012 Nov 1;1(8):1305-1312
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image

- Experimental details
- Western blot analysis using Anti-ARG1 antibody HPA024006 (A) shows similar pattern to independent antibody HPA003595 (B).
- Sample type
- HUMAN
- Antibody #2 product nr
- HPA003595
- Antibody provider
- Atlas Antibodies
- Show more
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human liver shows high expression.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human pancreas shows low expression as expected.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image

- Experimental details
- Immunohistochemistry analysis in human liver and pancreas tissues using Anti-ARG1 antibody. Corresponding ARG1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Show more