Antibody data
- Antibody Data
- Antigen structure
- References [6]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA003595 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA003595, RRID:AB_1078190
- Product name
- Anti-ARG1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
TIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLK
EQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKA
SEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGH
ARVHPDLGVIWVDA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Arginase regulates red blood cell nitric oxide synthase and export of cardioprotective nitric oxide bioactivity.
Local arginase inhibition during early reperfusion mediates cardioprotection via increased nitric oxide production.
Arginase Inhibition Improves Endothelial Function in Patients With Coronary Artery Disease and Type 2 Diabetes Mellitus
Arginase inhibition restores in vivo coronary microvascular function in type 2 diabetic rats
Arginase-1: a new immunohistochemical marker of hepatocytes and hepatocellular neoplasms.
A quantitative proteomic approach for identification of potential biomarkers in hepatocellular carcinoma.
Yang J, Gonon AT, Sjöquist PO, Lundberg JO, Pernow J
Proceedings of the National Academy of Sciences of the United States of America 2013 Sep 10;110(37):15049-54
Proceedings of the National Academy of Sciences of the United States of America 2013 Sep 10;110(37):15049-54
Local arginase inhibition during early reperfusion mediates cardioprotection via increased nitric oxide production.
Gonon AT, Jung C, Katz A, Westerblad H, Shemyakin A, Sjöquist PO, Lundberg JO, Pernow J
PloS one 2012;7(7):e42038
PloS one 2012;7(7):e42038
Arginase Inhibition Improves Endothelial Function in Patients With Coronary Artery Disease and Type 2 Diabetes Mellitus
Shemyakin A, Kovamees O, Rafnsson A, Bohm F, Svenarud P, Settergren M, Jung C, Pernow J
Circulation 2012 December;126(25):2943-2950
Circulation 2012 December;126(25):2943-2950
Arginase inhibition restores in vivo coronary microvascular function in type 2 diabetic rats
Gronros J, Jung C, Lundberg J, Cerrato R, Ostenson C, Pernow J
AJP: Heart and Circulatory Physiology 2011 March;300(4)
AJP: Heart and Circulatory Physiology 2011 March;300(4)
Arginase-1: a new immunohistochemical marker of hepatocytes and hepatocellular neoplasms.
Yan BC, Gong C, Song J, Krausz T, Tretiakova M, Hyjek E, Al-Ahmadie H, Alves V, Xiao SY, Anders RA, Hart JA
The American journal of surgical pathology 2010 Aug;34(8):1147-54
The American journal of surgical pathology 2010 Aug;34(8):1147-54
A quantitative proteomic approach for identification of potential biomarkers in hepatocellular carcinoma.
Chaerkady R, Harsha HC, Nalli A, Gucek M, Vivekanandan P, Akhtar J, Cole RN, Simmers J, Schulick RD, Singh S, Torbenson M, Pandey A, Thuluvath PJ
Journal of proteome research 2008 Oct;7(10):4289-98
Journal of proteome research 2008 Oct;7(10):4289-98
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Western blot analysis using Anti-ARG1 antibody HPA003595 (A) shows similar pattern to independent antibody HPA024006 (B).
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human liver and kidney tissues using HPA003595 antibody. Corresponding ARG1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human bone marrow shows strong cytoplasmic and nuclear positivity in a subset of hematopoietic cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human hepatocellular carcinoma shows moderate cytoplasmic and nuclear positivity in tumor cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows no positivity in cells in tubules as expected.
- Sample type
- HUMAN