HPA003595

ARG1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003595
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003595, RRID:AB_1078190
Product name
Anti-ARG1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003595
Antibody type
Polyclonal
Antigen
Arginase-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLK
EQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKA
SEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGH
ARVHPDLGVIWVDA
Storage
-20C
Provider Type Product Number
- No reagents -