HPA003564

FCGBP antibody from Atlas Antibodies
FC(GAMMA)BP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003564
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003564, RRID:AB_2231648
Product name
Anti-FCGBP
Provider product page
Atlas Antibodies - HPA003564
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LQAGDVVEFEVRPSWPLYLSANVGIQVLLFGTGAI
RNEVTYDPYLVLIPDVAAYCPAYVVKSVPGCEGVA
LVVAQTKAISGLTIDGHAVGAKLTWEAVPGSEFSY
AEVELGTADMIHTAEATTNLGLLT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -