HPA003517

FCGBP antibody from Sigma-Aldrich
FC(GAMMA)BP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003517
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003517, RRID:AB_1078838
Product name
Anti-FCGBP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003517
Antibody type
Polyclonal
Antigen
IgGFc-binding protein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GHRFDFQGTCEYLLSAPCHGPPLGAENFTVTVANE
HRGSQAVSYTRSVTLQIYNHSLTLSARWPRKLQVD
GVFVALPFQLDSLLHAHLSGADVVVTTTSGLSLAF
DGDSF
Storage
-20C
Provider Type Product Number
- No reagents -