HPA001177

LRFN5 antibody from Sigma-Aldrich
C14orf146, FIGLER8, SALM5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001177
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001177, RRID:AB_1079274
Product name
Anti-LRFN5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001177
Antibody type
Polyclonal
Antigen
Leucine-rich repeat and fibronectin type-III domain-containing protein 5 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PEGKLISNATRSLVYDNGTLDILITTVKDTGAFTC
IASNPAGEATQIVDLHIIKLPHLLNSTNHIHEPDP
GSSDISTSTKSGSNTSSSNGDTKLSQDKIVVAEAT
SSTALLKFNFQRNIPGIRMFQIQYNGTYDDTLVYR
MIPP
Storage
-20C
Provider Type Product Number
- No reagents -