HPA001481

PTS antibody from Sigma-Aldrich
PTPS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001481
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001481, RRID:AB_1079716
Product name
Anti-PTS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001481
Antibody type
Polyclonal
Antigen
6-Pyruvoyltetrahydrobiopterin synthase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RCQAQVSRRISFSASHRLYSKFLSDEENLKLFGKC
NNPNGHGHNYKVVVTVHGEIDPATGMVMNLADLKK
YMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVY
IWDNLQKVLPVGVLYKVKVYETDNNIV
Storage
-20C
Provider Type Product Number
- No reagents -