Antibody data

Product number
H00000883-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000883-M02, RRID:AB_1136907
Product name
CCBL1 monoclonal antibody (M02), clone 1B12
Provider product page
Abnova Corporation - H00000883-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant CCBL1.
Antigen sequence
MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQ
GFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFVII
IEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELG
SSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKV
FSREELELVASLCQQHDVVCITDEVYQWMVYDGHQ
HISIASLPGMWERTLTIGSAGKTFSATGWKVGWVL
GPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFERE
QLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLK
PIIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRR
FVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFC
FVKDEATLQAMDEKLRKWKVELWP
Isotype
IgG
Antibody clone number
1B12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -