HPA027736

KYAT1 antibody from Sigma-Aldrich
CCBL1, GTK, KATI
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027736
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027736, RRID:AB_10611818
Product name
Anti-CCBL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027736
Antibody type
Polyclonal
Antigen
cysteine conjugate-beta lyase, cytoplasmic recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQ
GFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFGYP
PLTKILASFFGELLGQEIDPLRNVLVTVGGYG
Storage
-20C
Provider Type Product Number
- No reagents -