HPA023849

ZNF521 antibody from Sigma-Aldrich
EHZF, Evi3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023849
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023849, RRID:AB_1859316
Product name
Anti-ZNF521 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023849
Antibody type
Polyclonal
Antigen
Zinc finger protein 521 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VTVGYTSVSSTTPDSNLSVDSSTMVEAAPPIPKSR
GRKRAAQQTPDMTGPSSKQAKVTYSCIYCNKQLFS
SLAVLQIHLKTMH
Storage
-20C
Provider Type Product Number
- No reagents -