Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [7]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb90890 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb90890, RRID:AB_2665712
- Product name
- Anti-OCLN
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
DKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYV
ERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVV
QELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGR
AGRSKRTEQDHYETDYTTGGESCDELEED- Epitope
- Binds to an epitope located within the peptide sequence NDKRFYPESSYKSTP as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL1567
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa]Lane 2: Human cell line CACO-2Lane 3: Human cell line U-87
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of CACO-2 cells using the Anti-OCLN monoclonal antibody, showing specific staining in cell junctions in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human breast cancer shows membranous immunoreactivity in tumor cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows membranous immunoreactivity in hepatocytes.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows membranous positivity in renal tubules.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate cancer shows membranous positivity in tumor cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows strong membranous immunoreactivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows membranous immunoreactivity in squamous epithelium cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows absence of immunoreactivity in lymphoid cells (negative control).
