HPA001637

TJP1 antibody from Atlas Antibodies
DKFZp686M05161, MGC133289, ZO-1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001637
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001637, RRID:AB_1080760
Product name
Anti-TJP1
Provider product page
Atlas Antibodies - HPA001637
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ASSQPAKPTKVTLVKSRKNEEYGLRLASHIFVKEI
SQDSLAARDGNIQEGDVVLKINGTVTENMSLTDAK
TLIERSKGKLKMVVQRDERATLLNVPDLSDSIHSA
NASERDDISEIQSLASDHSGR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -