HPA001637

TJP1 antibody from Sigma-Aldrich
DKFZp686M05161, MGC133289, ZO-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001637
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001637, RRID:AB_1080760
Product name
Anti-TJP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001637
Antibody type
Polyclonal
Antigen
Tight junction protein ZO-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ASSQPAKPTKVTLVKSRKNEEYGLRLASHIFVKEI
SQDSLAARDGNIQEGDVVLKINGTVTENMSLTDAK
TLIERSKGKLKMVVQRDERATLLNVPDLSDSIHSA
NASERDDISEIQSLASDHSGR
Storage
-20C
Provider Type Product Number
- No reagents -