HPA001813

TJP2 antibody from Atlas Antibodies
DFNA51, X104, ZO-2, ZO2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001813
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001813, RRID:AB_1080764
Product name
Anti-TJP2
Provider product page
Atlas Antibodies - HPA001813
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATK
DGNLHEGDIILKINGTVTENMSLTDARKLIEKSRG
KLQLVVLRDSQQTLINIPSLNDSDSEIEDISEIES
NRSFSPEERRHQYSDYDYHSSSEKLKERPSSREDT
PSRLSRMG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -