HPA001814

SOD2 antibody from Atlas Antibodies
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001814
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001814, RRID:AB_611822
Product name
Anti-SOD2
Provider product page
Atlas Antibodies - HPA001814
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEP
HINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAK
GDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGG
GEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGS
GWGWL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -