Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310726 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Superoxide Dismutase 1, Soluble (SOD1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SOD1 antibody: synthetic peptide directed towards the N terminal of human SOD1
- Description
- Protein A purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGS
IKGLT EGLHGFHVHE- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Sporadic amyotrophic lateral sclerosis and breast cancer: Hyaline conglomerate inclusions lead to identification of SOD1 mutation.
Immunoglobulin G distribution in multiple sclerosis brain. An immunofluorescence study.
Hays AP, Naini A, He CZ, Mitsumoto H, Rowland LP
Journal of the neurological sciences 2006 Mar 15;242(1-2):67-9
Journal of the neurological sciences 2006 Mar 15;242(1-2):67-9
Immunoglobulin G distribution in multiple sclerosis brain. An immunofluorescence study.
Tavolato BF
Journal of the neurological sciences 1975 Jan;24(1):1-11
Journal of the neurological sciences 1975 Jan;24(1):1-11
No comments: Submit comment
No validations: Submit validation data