HPA021327

IER5L antibody from Sigma-Aldrich
bA247A12.2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021327
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021327, RRID:AB_2121674
Product name
Anti-IER5L antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021327
Antibody type
Polyclonal
Antigen
Immediate early response gene 5-like protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PSDFGLHCSSQTTVLDLDTHVVTTVENGYLHQDCC
ASAHCPCCGQGAPGPGLASAAGCKRKYYPGQEEEE
DDEEDAG
Storage
-20C
Provider Type Product Number
- No reagents -