Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002936-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002936-M01, RRID:AB_464400
- Product name
- GSR monoclonal antibody (M01), clone 6B4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GSR.
- Antigen sequence
TVVFSHPPIGTVGLTEDEAIHKYGIENVKTYSTSF
TPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGL
GCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEE
LVTLR- Isotype
- IgG
- Antibody clone number
- 6B4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- GSR monoclonal antibody (M01), clone 6B4 Western Blot analysis of GSR expression in IMR-32 ( Cat # L008V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of GSR expression in transfected 293T cell line by GSR monoclonal antibody (M01), clone 6B4.Lane 1: GSR transfected lysate(56.3 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged GSR is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to GSR on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 6 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol