Antibody data

Product number
ABIN406391
Provider
antibodies-online
Product name
anti-Glutathione Reductase (GSR) antibody
Provider product page
antibodies-online - ABIN406391
Antibody type
Polyclonal
Antigen
The immunogen for anti-GSR antibody: synthetic peptide directed towards the N terminal of human GSR
Reactivity
Human, Mouse, Rat, Bovine, Porcine
Host
Rabbit
Antigen sequence
PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGAS
LGITS DGFFQLEELP
Vial size
50 µg
Provider Type Product Number
- No reagents -