HPA001538

GSR antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001538
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001538, RRID:AB_1078986
Product name
Anti-GSR antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001538
Antibody type
Polyclonal
Antigen
Glutathione reductase, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GFPSCEGKFNWRVIKEKRDAYVSRLNAIYQNNLTK
SHIEIIRGHAAFTSDPKPTIEVSGKKYTAPHILIA
TGGMPSTPHESQIPGASLGITSDGFFQLEELPGRS
VIVGAGYIAVEMAGILS
Storage
-20C
Provider Type Product Number
- No reagents -