Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [2]
- Immunohistochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA045595 - Provider product page

- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA045595, RRID:AB_10964447
- Product name
- Anti-OR8S1
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ERSLRDSSHLPQLHKGQARWKRPAFTEGRREPGHP
ELSIPVTPQP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image

- Experimental details
- Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY423797)
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane.
- Sample type
- Human
- Submitted by
- Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane.
- Sample type
- Human
- Protocol
- Protocol
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
- Sample type
- Human
- Protocol
- Protocol