Antibody data

Product number
H00002624-M05A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002624-M05A, RRID:AB_1575096
Product name
GATA2 monoclonal antibody (M05A), clone 1A5
Provider product page
Abnova Corporation - H00002624-M05A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant GATA2.
Antigen sequence
MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYME
PAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARV
SYSPAHARLTGGQMCRPHLLHSPGLPWLDGGK
Isotype
IgG
Antibody clone number
1A5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -