Explore
Validate
Learn
Western blot
Chromatin ImmunoprecipitationAntibody data
- Antibody Data
- Antigen structure
- References [6]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182422 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-GATA Binding Protein 2 (GATA2) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GATA2 antibody: synthetic peptide directed towards the N terminal of human GATA2
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus
- Host
- Rabbit
- Antigen sequence
PYYANPAHARARVSYSPAHARLTGGQMCRPHLLHS
PGLPW LDGGKAALSA- Vial size
- 0.1 mg
Submitted references A regulatory circuit comprising GATA1/2 switch and microRNA-27a/24 promotes erythropoiesis.
Gene expression profiling identifies HOXB4 as a direct downstream target of GATA-2 in human CD34+ hematopoietic cells.
The functional IGFBP7 promoter -418G>A polymorphism and risk of head and neck cancer.
GATA proteins work together with friend of GATA (FOG) and C-terminal binding protein (CTBP) co-regulators to control adipogenesis.
A mechanosensitive transcriptional mechanism that controls angiogenesis.
Cross talk between retinoic acid signaling and transcription factor GATA-2.
Wang F, Zhu Y, Guo L, Dong L, Liu H, Yin H, Zhang Z, Li Y, Liu C, Ma Y, Song W, He A, Wang Q, Wang L, Zhang J, Li J, Yu J
Nucleic acids research 2014 Jan;42(1):442-57
Nucleic acids research 2014 Jan;42(1):442-57
Gene expression profiling identifies HOXB4 as a direct downstream target of GATA-2 in human CD34+ hematopoietic cells.
Fujiwara T, Yokoyama H, Okitsu Y, Kamata M, Fukuhara N, Onishi Y, Fujimaki S, Takahashi S, Ishizawa K, Bresnick EH, Harigae H
PloS one 2012;7(9):e40959
PloS one 2012;7(9):e40959
The functional IGFBP7 promoter -418G>A polymorphism and risk of head and neck cancer.
Huang YJ, Niu J, Liu Z, Wang LE, Sturgis EM, Wei Q
Mutation research 2010 Sep 30;702(1):32-9
Mutation research 2010 Sep 30;702(1):32-9
GATA proteins work together with friend of GATA (FOG) and C-terminal binding protein (CTBP) co-regulators to control adipogenesis.
Jack BH, Crossley M
The Journal of biological chemistry 2010 Oct 15;285(42):32405-14
The Journal of biological chemistry 2010 Oct 15;285(42):32405-14
A mechanosensitive transcriptional mechanism that controls angiogenesis.
Mammoto A, Connor KM, Mammoto T, Yung CW, Huh D, Aderman CM, Mostoslavsky G, Smith LE, Ingber DE
Nature 2009 Feb 26;457(7233):1103-8
Nature 2009 Feb 26;457(7233):1103-8
Cross talk between retinoic acid signaling and transcription factor GATA-2.
Tsuzuki S, Kitajima K, Nakano T, Glasow A, Zelent A, Enver T
Molecular and cellular biology 2004 Aug;24(15):6824-36
Molecular and cellular biology 2004 Aug;24(15):6824-36
No comments: Submit comment
No validations: Submit validation data