HPA005633

GATA2 antibody from Sigma-Aldrich
NFE1B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005633
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005633, RRID:AB_1078954
Product name
Anti-GATA2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005633
Antibody type
Polyclonal
Antigen
Endothelial transcription factor GATA-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHH
NPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGS
GGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSP
DPSTTGAASPASSSAGGSAARG
Storage
-20C
Provider Type Product Number
- No reagents -