HPA023313

GSDMA antibody from Atlas Antibodies
FLJ39120, GSDM, GSDM1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023313
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023313, RRID:AB_1850378
Product name
Anti-GSDMA
Provider product page
Atlas Antibodies - HPA023313
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VGALTELSEAQQKLLVKSMEKKILPVQLKLVESTM
EQNFLLDKEGVFPLQPELLSSLGDEELTLTEALVG
LSGLEVQRSGPQYMWDPDTLPRLCALYAGLSLLQQ
LTKAS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -