HPA064826

GSDMA antibody from Atlas Antibodies
FLJ39120, GSDM, GSDM1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA064826
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA064826, RRID:AB_2685361
Product name
Anti-GSDMA
Provider product page
Atlas Antibodies - HPA064826
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DLTPLDSLIDFKRFHPFCLVLRKRKSTLFWGARYV
RTDYTLLDVLEPGSSPSDPTDTGNFGFKNMLDTRV
EGDVDVPKTVKVKGTAG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -