HPA064826

antibody from Atlas Antibodies

Targeting: GSDMA FLJ39120, GSDM, GSDM1

Antibody data

Submit

Validation data

Product number: HPA064826 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA064826, RRID:AB_2685361
Product name: Anti-GSDMA
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: DLTPLDSLIDFKRFHPFCLVLRKRKSTLFWGARYV RTDYTLLDVLEPGSSPSDPTDTGNFGFKNMLDTRV EGDVDVPKTVKVKGTAG
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

GSDMA protein structure - HPA064826 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human skin and pancreas tissues using Anti-GSDMA antibody. Corresponding GSDMA RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human lymph node, skin, skin and skin, hairy using Anti-GSDMA antibody HPA064826 (A) shows similar protein distribution across tissues to independent antibody HPA023313 (B).
Antibody #2 product nr: HPA023313
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin shows strong cytoplasmic and nuclear positivity in cells in sebaceous glands.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin, hairy using Anti-GSDMA antibody HPA064826.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-GSDMA antibody HPA064826.
Sample type: HUMAN