PAB21557

GSDMA antibody from Abnova Corporation
FLJ39120, GSDM, GSDM1

Antibody data

Product number
PAB21557
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21557, RRID:AB_10965388
Product name
GSDMA polyclonal antibody
Provider product page
Abnova Corporation - PAB21557
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant GSDMA.
Antigen sequence
VGALTELSEAQQKLLVKSMEKKILPVQLKLVESTM
EQNFLLDKEGVFPLQPELLSSLGDEELTLTEALVG
LSGLEVQRSGPQYMWDPDTLPRLCALYAGLSLLQQ
LTKAS
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -