PAB21662

GSDMA antibody from Abnova Corporation
FLJ39120, GSDM, GSDM1

Antibody data

Product number
PAB21662
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21662, RRID:AB_10964248
Product name
GSDMA polyclonal antibody
Provider product page
Abnova Corporation - PAB21662
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human GSDMA.
Reactivity
Human
Host
Rabbit
Antigen sequence
DHPFLKEMQDQGENLYVVMEVVETVQEVTLERAGK
AEACFSLPFFAPLGLQGSINHKEAVTIPKGCVLAF
RVRQLMVKGKDEWDIP
Isotype
IgG
Vial size
100 uL
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -