HPA024207

GSDMA antibody from Sigma-Aldrich
FLJ39120, GSDM, GSDM1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024207
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024207, RRID:AB_1850380
Product name
Anti-GSDMA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024207
Antibody type
Polyclonal
Antigen
Gasdermin-A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DHPFLKEMQDQGENLYVVMEVVETVQEVTLERAGK
AEACFSLPFFAPLGLQGSINHKEAVTIPKGCVLAF
RVRQLMVKGKDEWDIP
Storage
-20C
Provider Type Product Number
- No reagents -