HPA019965

DGCR8 antibody from Sigma-Aldrich
C22orf12, DGCRK6, Gy1, pasha
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019965
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019965, RRID:AB_1847634
Product name
Anti-DGCR8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019965
Antibody type
Polyclonal
Antigen
Protein DGCR8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YGASLLSKGSFSKGRLLIDPNCSGHSPRTARHAPA
VRKFSPDLKLLKDVKISVSFTESCRSKDRKVLYTG
AERDVRAECGLLLSPVSGDVHACPFGGSVGDGVGI
GGESADKKDEENELDQEKRVEYAVLDELEDFTDNL
ELDEEGAGGFTAKAIVQRDRVDEEALNFPYEDDFD
NDVDAL
Storage
-20C
Provider Type Product Number
- No reagents -