H00003850-B01P

KRT3 antibody from Abnova Corporation
CK3, K3
No application information provided.

Antibody data

Product number
H00003850-B01P
Provider
Abnova Corporation
Product name
KRT3 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00003850-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human KRT3 protein.
Antigen sequence
MSRQASKTSGGGSQGFSGRSAVVSGSSRMSCVAHS
GGAGGGAYGFRSGAGGFGSRSLYNLGGNKSISISV
AAGGSRAGGFGGGRSSCAFAGGYGGGFGSGYGGGF
GGGFGGGRGMGGGFGGAGGFGGAGGFGGAGGFGGP
GGFGGSGGFGGPGSLGSPGGFGPGGFPGGIQEVTI
NQSLLQPLNVEIDPQIGQVKAQEREQIKTLNNKFA
SFIDKVRFLEQQNKVLETKWNLLQQQGTSSISGTN
NLEPLFENHINYLRSYLDNILGERGRLDSELKNME
DLVEDFKKKYEDEINKRTAAENEFVTLKKDVDSAY
MNKVELQAKVDALIDEIDFLRTLYDAELSQMQSHI
SDTSVVLSMDNNRSLDLDSIIAEVRAQYEDIAQRS
KAEAEALYQTKLGELQTTAGRHGDDLRNTKSEIIE
LNRMIQRLRAEIEGVKKQNANLQTAIAEAEQHGEM
ALKDANAKLQELQAALQQAKDDLARLLRDYQELMN
VKLALDVEIATYRKLLEGEEYRMSGECPSAVSISV
VSSSTTSASAGGYGGGYGGGMGGGLGGGFSAGGGS
GSGFGRGGGGGIGGGFGGGSSGFSGGSGFGSISGA
RYGVSGGGFSSASNRGGSIKFSQSSQSSQRYSR
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -