Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA002082 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA002082, RRID:AB_1080575
- Product name
- Anti-VWF
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RITLLLMASQEPQRMSRNFVRYVQGLKKKKVIVIP
VGIGPHANLKQIRLIEKQAPENKAFVLSSVDELEQ
QRDEIVSYLCDLAPEAPPPTLPPDMAQVTVGPGLL
GVSTLGPKRNSMVLDVAFVL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Affinity Proteomics Reveals Elevated Muscle Proteins in Plasma of Children with Cerebral Malaria
Semaphorin 3A suppresses tumor growth and metastasis in mice melanoma model.
Bachmann J, Burté F, Pramana S, Conte I, Brown B, Orimadegun A, Ajetunmobi W, Afolabi N, Akinkunmi F, Omokhodion S, Akinbami F, Shokunbi W, Kampf C, Pawitan Y, Uhlén M, Sodeinde O, Schwenk J, Wahlgren M, Fernandez-Reyes D, Nilsson P, Kim K
PLoS Pathogens 2014 April;10(4)
PLoS Pathogens 2014 April;10(4)
Semaphorin 3A suppresses tumor growth and metastasis in mice melanoma model.
Chakraborty G, Kumar S, Mishra R, Patil TV, Kundu GC
PloS one 2012;7(3):e33633
PloS one 2012;7(3):e33633
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human appendix shows secreted positivity in blood vessels.
- Sample type
- HUMAN