HPA001815

VWF antibody from Sigma-Aldrich
F8VWF
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001815
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001815, RRID:AB_1080574
Product name
Anti-VWF antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001815
Antibody type
Polyclonal
Antigen
von Willebrand factor precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ARSNRVTVFPIGIGDRYDAAQLRILAGPAGDSNVV
KLQRIEDLPTMVTLGNSFLHKLCSGFVRICMDEDG
NEKRPGDVWTLPDQCHTVTCQPDGQTLLKSHRVNC
DRGLRPSCPNSQSPVKVEKT
Storage
-20C
Provider Type Product Number
- No reagents -