HPA022800

MSL1 antibody from Atlas Antibodies
DKFZp686P24239, hMSL1, MSL-1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA022800
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA022800, RRID:AB_1853057
Product name
Anti-MSL1
Provider product page
Atlas Antibodies - HPA022800
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QQQQLQAKEKEIEELKSERDTLLARIERMERRMQL
VKKDNEKERHKLFQGYETEEREETELSEKIKLECQ
PELSETSQTLPPKPFSCGRSGKGHK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -