HPA022800

MSL1 antibody from Sigma-Aldrich
DKFZp686P24239, hMSL1, MSL-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022800
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022800, RRID:AB_1853057
Product name
Anti-MSL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022800
Antibody type
Polyclonal
Antigen
Male-specific lethal 1 homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QQQQLQAKEKEIEELKSERDTLLARIERMERRMQL
VKKDNEKERHKLFQGYETEEREETELSEKIKLECQ
PELSETSQTLPPKPFSCGRSGKGHK
Storage
-20C
Provider Type Product Number
- No reagents -