PAB20006

RALGAPA1 antibody from Abnova Corporation
DKFZp667F074, GARNL1, GRIPE, KIAA0884, RalGAPalpha1, Tulip1

Antibody data

Product number
PAB20006
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20006, RRID:AB_10964833
Product name
RALGAPA1 polyclonal antibody
Provider product page
Abnova Corporation - PAB20006
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant RALGAPA1.
Antigen sequence
LVSCIQIRSEENMPGGGLSAGLASANSNVRIIVRD
LSGKYSWDSAILYGPPPVSGLSEPTSFMLSLSHQE
KPEEPPTSNECLEDITVKDGLSLQFKRFRETVPTW
DTIRDEEDVLDELLQYLGVTSPECLQRTGISLNIP
APQPVCISE
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -