HPA000851

RALGAPA1 antibody from Sigma-Aldrich
DKFZp667F074, GARNL1, GRIPE, KIAA0884, RalGAPalpha1, Tulip1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000851
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000851, RRID:AB_1078945
Product name
Anti-GARNL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000851
Antibody type
Polyclonal
Antigen
GTPase-activating Rap/Ran-GAP domain-like 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LVSCIQIRSEENMPGGGLSAGLASANSNVRIIVRD
LSGKYSWDSAILYGPPPVSGLSEPTSFMLSLSHQE
KPEEPPTSNECLEDITVKDGLSLQFKRFRETVPTW
DTIRDEEDVLDELLQYLGVTSPECLQRTGISLNIP
APQPVCISE
Storage
-20C
Provider Type Product Number
- No reagents -