HPA026557

TBCE antibody from Sigma-Aldrich
HRD, KCS, KCS1, pac2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026557
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026557, RRID:AB_1857798
Product name
Anti-TBCE antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026557
Antibody type
Polyclonal
Antigen
Tubulin-specific chaperone E recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DWELKTQQPLMLKNQLLTLKIKYPHQLDQKVLEKQ
LPGSMTIQKVKGLLSRLLKVPVSDLLLSYESPKKP
GREIELENDLKSLQFYSVENGDCLLVRW
Storage
-20C
Provider Type Product Number
- No reagents -