HPA018290

ZNF251 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018290
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018290, RRID:AB_1859153
Product name
Anti-ZNF251 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018290
Antibody type
Polyclonal
Antigen
Zinc finger protein 251 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EFREAWGREGKLKERVGNSAGQSLNKPNIHKRVLT
EATVGRERSLGERTQECSAFDRNLNLDQNVVRLQR
NKTG
Storage
-20C
Provider Type Product Number
- No reagents -