H00005983-M23

RFC3 antibody from Abnova Corporation
MGC5276, RFC38
No application information provided.

Antibody data

Product number
H00005983-M23
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005983-M23, RRID:AB_1579712
Product name
RFC3 monoclonal antibody (M23), clone 1B6
Provider product page
Abnova Corporation - H00005983-M23
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant RFC3.
Antigen sequence
MSLWVDKYRPCSLGRLDYHKEQAAQLRNLVQCGDF
PHLLVYGPSGAGKKTRIMCILRELYGVGVEKLRIE
HQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDR
VVIQEMLKTVAQSQQLETNSQGDFKVVLLTEVDKL
TKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPI
RSRCLAVRVPAPSIEDICHVLSTVCKKEGLNLPSQ
LAHRLAEKSCRNLRKALLMCEACRVQQYPFTADQE
IPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYE
LLTHCIPPEIIMKGLLSELLHNCGGQLKGEVAQMA
AYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDG
LEGMMF
Isotype
IgG
Antibody clone number
1B6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -