HPA005550

PROC antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005550
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005550, RRID:AB_1079687
Product name
Anti-PROC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005550
Antibody type
Polyclonal
Antigen
Vitamin K-dependent protein C precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AHCMDESKKLLVRLGEYDLRRWEKWELDLDIKEVF
VHPNYSKSTTDNDIALLHLAQPATLSQTIVPICLP
DSGLAERELNQAGQETLVTGWGYHSSREKEAKRNR
TFVLNFIKIPVVPHNECSEVMSNMVSENMLCAGI
Storage
-20C
Provider Type Product Number
- No reagents -