HPA002982

THBD antibody from Sigma-Aldrich
CD141
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002982
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002982, RRID:AB_1078444
Product name
Anti-THBD antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002982
Antibody type
Polyclonal
Antigen
Thrombomodulin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DVISLLLNGDGGVGRRRLWIGLQLPPGCGDPKRLG
PLRGFQWVTGDNNTSYSRWARLDLNGAPLCGPLCV
AVSAAEATVPSEPIWEEQQCEVKADGFLCEFHFPA
TCRPLAVEPGAAAAAVSITYG
Storage
-20C
Provider Type Product Number
- No reagents -